PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof018934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 149aa    MW: 16569.4 Da    PI: 10.4452
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-44603PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-143579147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
        Sof018934 35 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 79
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.32E-172985IPR009057Homeodomain-like
PROSITE profilePS5129415.4083084IPR017930Myb domain
TIGRFAMsTIGR015573.7E-193382IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.7E-73385IPR009057Homeodomain-like
SMARTSM007175.3E-113482IPR001005SANT/Myb domain
PfamPF002497.2E-123579IPR001005SANT/Myb domain
CDDcd001673.09E-93780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MVSASAPPPP QSDAAGSGED ASKKVRKPYT ITKSRESWTE QEHDKFLEAL QLFDRDWKKI  60
EAFVGSKTVI QIRSHAQKYF LKVQKNGTSE HVPPPRPKRK AAHPYPQKAS KNEPNYGLKT  120
DSSSIHRNPG MNVSGSSWAH KSIPQACGX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.160271e-58crown| leaf| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452755.13e-99hypothetical protein SORBIDRAFT_04g031820
SwissprotQ8RWU33e-64RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A0C6WCP91e-102A0A0C6WCP9_9POAL; ScMYB40 protein
STRINGSb04g031820.11e-98(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.15e-47MYB_related family protein